Best for
- Optimizing gene sequences for heterologous expression (codon adaptation)
- Simulating gene circuit dynamics (toggle switches, repressilators, inducible systems)
- Creating standardized SBML models of biological networks
synthetic-sciences/openscience/backend/cli/skills/biology/synthetic-biology/SKILL.md
Synthetic biology design and simulation tools. Codon optimization, gene circuit ODE modeling with growth feedback, SBML model creation, bifurcation analysis, barcode sequencing fitness analysis, and therapeutic genome engineering. For metabolic modeling use cobrapy; for sequence tools use biopython.
Decision brief
Synthetic biology design and simulation tools. Codon optimization, gene circuit ODE modeling with growth feedback, SBML model creation, bifurcation analysis, barcode sequencing fitness analysis, and therapeutic genome engineering.
In this controlled same-task single run, enabling synthetic-biology changed the output from 2772 non-whitespace characters and 13 headings to 2818 characters and 22 headings. Matches among 8 signals extracted from the pinned source changed from 2 to 2. Both actual outputs are shown; this is a structural observation, not a quality score or a universal performance claim.
Create a design direction and implementation handoff for a developer tool that compares two API responses. Prioritize the repeated user workflow and responsive behavior. The deliverable must specifically reflect this user intent: Synthetic biology design and simulation tools. Codon optimization, gene circuit ODE modeling with growth feedback, SBML model creation, bifurcation analysis, barcode sequencing fitness analysis, and therapeutic genome engineering. For metabolic modeling use cobrapy; for sequence tools use biopython.

Baseline: 2772 non-whitespace characters, 13 headings, and 71 list items.

With Skill: 2818 non-whitespace characters, 22 headings, and 57 list items.
| Observation | Without Skill | With Skill |
|---|---|---|
| Source-signal coverage | 2/8: synthetic, biology | 2/8: synthetic, biology |
| Output structure | 2772 chars · 13 headings · 71 list items · 1 code blocks | 2818 chars · 22 headings · 57 list items · 1 code blocks |
| Verification and caution signals | 4 verification signals · 5 risk/limitation signals | 5 verification signals · 19 risk/limitation signals |
Use the synthetic-biology Skill pinned at 0e1e42e75212 for my task. Follow its source-specific constraints around `synthetic-biology`, `synthetic`, `biology`, `design`, then return the finished deliverable with explicit assumptions, verification, failure conditions, and limits. Do not treat the Skill text as a factual source or claim that a single demonstration proves universal performance.
Compatibility matrix
| Platform | Status | Evidence | What to check |
|---|---|---|---|
| Codex | Not declared | No explicit evidence | Portability before use |
| Claude Code | Not declared | No explicit evidence | Portability before use |
| Cursor | Not declared | No explicit evidence | Portability before use |
| Gemini CLI | Not declared | No explicit evidence | Portability before use |
Installation
The source command is displayed only when detected. A safe inspection prompt is always available so your agent can explain every action before execution.
npx skills add https://github.com/synthetic-sciences/openscience --skill "backend/cli/skills/biology/synthetic-biology"Inspect the Agent Skill "synthetic-biology" from https://github.com/synthetic-sciences/openscience/blob/95be136c06386eb18546ce94d134d2c7e66976ac/backend/cli/skills/biology/synthetic-biology/SKILL.md at commit 95be136c06386eb18546ce94d134d2c7e66976ac. List every install step, command, network request, credential, file read/write, external action, and rollback step. Explain whether it fits my task. Do not install or execute anything until I approve.
Workflow
python import numpy as np from scipy.integrate import solveivp
ECOLICODONTABLE = { 'F': {'TTT': 0.58, 'TTC': 0.42}, 'L': {'TTA': 0.11, 'TTG': 0.11, 'CTT': 0.10, 'CTC': 0.10, 'CTA': 0.04, 'CTG': 0.54}, 'I': {'ATT': 0.49, 'ATC': 0.39, 'ATA': 0.07}, 'M': {'ATG': 1.0}, 'V': {'GTT': 0.28, 'GTC': 0.20, 'GTA': 0.17, 'GTG': 0.35}, 'S': {'TCT': 0.17…
Review the “Workflow 1: Optimize Gene for E. coli Expression and Calculate CAI” section in the pinned source before continuing.
Review the “Workflow 2: Simulate Toggle Switch with Growth Dilution” section in the pinned source before continuing.
Review the “Workflow 3: Create SBML Model of a Metabolic Pathway” section in the pinned source before continuing.
Permission review
The documentation asks the agent to create, modify, or delete local files.
# Write to fileEvidence record
| Signal | Value | Evidence type | Meaning |
|---|---|---|---|
| Quality score | 94/100 | Computed | Documentation, specificity, maintenance, and trust rules |
| Repository stars | 3,338 | Source | Repository attention, not individual Skill quality |
| Compatibility | 0 platforms | Source | Declared in the catalog source record |
| Usage guide | tested outcome page | Tested | Generated or reviewed according to the visible evidence level |
Pinned source
Synthetic Biology provides computational tools for designing and simulating engineered biological systems. This skill covers codon optimization with species-specific usage tables, gene circuit ODE modeling (repressilator, toggle switch, inducible promoters) with growth dilution coupling, SBML model creation and validation using python-libsbml, bifurcation analysis for bistable circuits, barcode sequencing fitness analysis, and genome engineering with expression cassette insertion. All simulations produce quantitative outputs suitable for guiding experimental design.
Related Skills: For constraint-based metabolic modeling use cobrapy. For sequence manipulation and file parsing use biopython. For molecular cloning simulation use molecular-cloning.
uv pip install python-libsbml scipy biopython numpy pandas matplotlib
import numpy as np
from scipy.integrate import solve_ivp
# Toggle switch: two mutually repressing genes
def toggle_switch(t, y, alpha1, alpha2, beta, n, gamma):
u, v = y # Protein concentrations
du = alpha1 / (1 + v**n) - (beta + gamma) * u # gamma = growth dilution
dv = alpha2 / (1 + u**n) - (beta + gamma) * v
return [du, dv]
sol = solve_ivp(toggle_switch, [0, 50], [0.1, 3.0],
args=(5.0, 5.0, 0.5, 2.0, 0.1),
t_eval=np.linspace(0, 50, 500))
print(f"Final state: u={sol.y[0,-1]:.3f}, v={sol.y[1,-1]:.3f}")
print(f"Bistable: {'Yes' if abs(sol.y[0,-1] - sol.y[1,-1]) > 0.5 else 'No'}")
Optimize gene sequences for expression in target organisms.
import numpy as np
from collections import Counter
# E. coli codon usage table (fraction per amino acid)
ECOLI_CODON_TABLE = {
'F': {'TTT': 0.58, 'TTC': 0.42},
'L': {'TTA': 0.11, 'TTG': 0.11, 'CTT': 0.10, 'CTC': 0.10, 'CTA': 0.04, 'CTG': 0.54},
'I': {'ATT': 0.49, 'ATC': 0.39, 'ATA': 0.07},
'M': {'ATG': 1.0},
'V': {'GTT': 0.28, 'GTC': 0.20, 'GTA': 0.17, 'GTG': 0.35},
'S': {'TCT': 0.17, 'TCC': 0.15, 'TCA': 0.14, 'TCG': 0.14, 'AGT': 0.16, 'AGC': 0.25},
'P': {'CCT': 0.18, 'CCC': 0.13, 'CCA': 0.20, 'CCG': 0.49},
'T': {'ACT': 0.19, 'ACC': 0.40, 'ACA': 0.17, 'ACG': 0.25},
'A': {'GCT': 0.18, 'GCC': 0.26, 'GCA': 0.23, 'GCG': 0.33},
'Y': {'TAT': 0.59, 'TAC': 0.41},
'*': {'TAA': 0.61, 'TAG': 0.09, 'TGA': 0.30},
'H': {'CAT': 0.57, 'CAC': 0.43},
'Q': {'CAA': 0.34, 'CAG': 0.66},
'N': {'AAT': 0.49, 'AAC': 0.51},
'K': {'AAA': 0.74, 'AAG': 0.26},
'D': {'GAT': 0.63, 'GAC': 0.37},
'E': {'GAA': 0.68, 'GAG': 0.32},
'C': {'TGT': 0.46, 'TGC': 0.54},
'W': {'TGG': 1.0},
'R': {'CGT': 0.36, 'CGC': 0.36, 'CGA': 0.07, 'CGG': 0.11, 'AGA': 0.07, 'AGG': 0.04},
'G': {'GGT': 0.35, 'GGC': 0.37, 'GGA': 0.13, 'GGG': 0.15},
}
CODON_TO_AA = {}
for aa, codons in ECOLI_CODON_TABLE.items():
for codon in codons:
CODON_TO_AA[codon] = aa
def calculate_cai(dna_seq, codon_table=ECOLI_CODON_TABLE):
"""Calculate Codon Adaptation Index."""
codons = [dna_seq[i:i+3] for i in range(0, len(dna_seq)-2, 3)]
weights = []
for codon in codons:
aa = CODON_TO_AA.get(codon)
if aa and aa != '*':
aa_codons = codon_table[aa]
max_freq = max(aa_codons.values())
w = aa_codons.get(codon, 0) / max_freq if max_freq > 0 else 0
if w > 0:
weights.append(np.log(w))
cai = np.exp(np.mean(weights)) if weights else 0
return cai
def optimize_codons(protein_seq, codon_table=ECOLI_CODON_TABLE,
gc_min=0.40, gc_max=0.60):
"""Optimize codons for target organism."""
optimized = []
for aa in protein_seq:
if aa == '*':
break
if aa not in codon_table:
raise ValueError(f"Unknown amino acid: {aa}")
codons = codon_table[aa]
# Select highest-frequency codon
best_codon = max(codons, key=codons.get)
optimized.append(best_codon)
dna_seq = ''.join(optimized)
# Check GC content
gc = (dna_seq.count('G') + dna_seq.count('C')) / len(dna_seq)
cai = calculate_cai(dna_seq, codon_table)
print(f"Optimized sequence: {len(dna_seq)} bp")
print(f"GC content: {gc:.1%}")
print(f"CAI: {cai:.4f}")
if gc < gc_min or gc > gc_max:
print(f"WARNING: GC content {gc:.1%} outside target range [{gc_min:.0%}-{gc_max:.0%}]")
return dna_seq, cai, gc
# Example
protein = "MSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKL" # GFP fragment
opt_dna, cai, gc = optimize_codons(protein)
ODE models for common synthetic gene circuits.
import numpy as np
from scipy.integrate import solve_ivp
def repressilator(t, y, alpha, n, beta, gamma):
"""Repressilator: 3-gene oscillator (Elowitz & Leibler).
gamma = growth dilution rate."""
m1, p1, m2, p2, m3, p3 = y
dm1 = alpha / (1 + p3**n) - (beta + gamma) * m1
dp1 = m1 - (beta + gamma) * p1
dm2 = alpha / (1 + p1**n) - (beta + gamma) * m2
dp2 = m2 - (beta + gamma) * p2
dm3 = alpha / (1 + p2**n) - (beta + gamma) * m3
dp3 = m3 - (beta + gamma) * p3
return [dm1, dp1, dm2, dp2, dm3, dp3]
def inducible_promoter(t, y, V_max, Km, n, beta, gamma, inducer_conc):
"""Inducible gene expression (Hill function)."""
mRNA, protein = y
induction = V_max * inducer_conc**n / (Km**n + inducer_conc**n)
dmRNA = induction - (beta + gamma) * mRNA
dprotein = mRNA - (beta + gamma) * protein
return [dmRNA, dprotein]
# Simulate repressilator
y0 = [0.5, 1.0, 0.0, 0.0, 0.0, 0.0]
sol = solve_ivp(repressilator, [0, 200], y0,
args=(5.0, 2.0, 0.5, 0.1),
t_eval=np.linspace(0, 200, 2000),
method='RK45')
# Check for oscillation
from scipy.signal import find_peaks
peaks, _ = find_peaks(sol.y[1])
if len(peaks) > 2:
period = np.mean(np.diff(sol.t[peaks]))
print(f"Oscillation period: {period:.1f} time units")
print(f"Amplitude: {sol.y[1, peaks].mean() - sol.y[1].min():.3f}")
else:
print("No sustained oscillations detected")
# Parameter sensitivity analysis
def sensitivity_analysis(param_name, param_values, base_params, y0, t_span):
"""Sweep one parameter and measure output."""
results = []
for val in param_values:
params = base_params.copy()
params[param_name] = val
sol = solve_ivp(repressilator, t_span, y0,
args=tuple(params.values()),
t_eval=np.linspace(*t_span, 500))
# Measure amplitude
amplitude = sol.y[1].max() - sol.y[1].min()
results.append({'param_value': val, 'amplitude': amplitude})
return pd.DataFrame(results)
Build standardized SBML models with python-libsbml.
import libsbml
def create_sbml_model(model_name, compartments, species_list, reactions):
"""Create SBML Level 3 model.
Args:
model_name: string name
compartments: list of (id, size) tuples
species_list: list of (id, compartment, initial_amount) tuples
reactions: list of dicts with 'id', 'reactants', 'products', 'kinetic_law'
"""
doc = libsbml.SBMLDocument(3, 2)
model = doc.createModel()
model.setId(model_name)
# Compartments
for comp_id, size in compartments:
c = model.createCompartment()
c.setId(comp_id)
c.setConstant(True)
c.setSize(size)
c.setSpatialDimensions(3)
# Species
for sp_id, comp_id, init_amount in species_list:
s = model.createSpecies()
s.setId(sp_id)
s.setCompartment(comp_id)
s.setInitialAmount(init_amount)
s.setConstant(False)
s.setBoundaryCondition(False)
s.setHasOnlySubstanceUnits(False)
# Reactions
for rxn in reactions:
r = model.createReaction()
r.setId(rxn['id'])
r.setReversible(rxn.get('reversible', False))
for reactant_id, stoich in rxn.get('reactants', []):
sr = r.createReactant()
sr.setSpecies(reactant_id)
sr.setStoichiometry(stoich)
sr.setConstant(True)
for product_id, stoich in rxn.get('products', []):
sp = r.createProduct()
sp.setSpecies(product_id)
sp.setStoichiometry(stoich)
sp.setConstant(True)
kl = r.createKineticLaw()
kl.setMath(libsbml.parseL3Formula(rxn['kinetic_law']))
# Add parameters
for param_id, value in rxn.get('parameters', []):
p = kl.createLocalParameter()
p.setId(param_id)
p.setValue(value)
# Validate
errors = doc.getNumErrors()
if errors > 0:
for i in range(errors):
print(f"SBML Error: {doc.getError(i).getMessage()}")
return doc
# Example: simple enzymatic reaction
doc = create_sbml_model(
'enzyme_kinetics',
compartments=[('cell', 1.0)],
species_list=[('S', 'cell', 10.0), ('P', 'cell', 0.0), ('E', 'cell', 1.0)],
reactions=[{
'id': 'v1',
'reactants': [('S', 1)],
'products': [('P', 1)],
'kinetic_law': 'Vmax * S / (Km + S)',
'parameters': [('Vmax', 1.0), ('Km', 0.5)]
}]
)
# Write to file
libsbml.writeSBMLToFile(doc, 'model.xml')
print("SBML model written to model.xml")
Identify bistability in gene circuits.
import numpy as np
from scipy.optimize import fsolve
def toggle_steady_states(alpha1, alpha2, n, beta):
"""Find steady states of toggle switch by sweeping inducer."""
def steady_state_eq(x, alpha1_eff, alpha2, n, beta):
u, v = x
eq1 = alpha1_eff / (1 + v**n) - beta * u
eq2 = alpha2 / (1 + u**n) - beta * v
return [eq1, eq2]
inducer_values = np.linspace(0, 10, 200)
stable_u = []
stable_v = []
for ind in inducer_values:
alpha1_eff = alpha1 * (1 + ind) # Inducer enhances gene 1 expression
solutions = []
# Try multiple initial conditions to find all steady states
for u0 in [0.01, 1.0, 5.0, 10.0]:
for v0 in [0.01, 1.0, 5.0, 10.0]:
try:
sol = fsolve(steady_state_eq, [u0, v0],
args=(alpha1_eff, alpha2, n, beta),
full_output=True)
if sol[2] == 1: # Converged
u, v = sol[0]
if u > 0 and v > 0:
solutions.append((round(u, 4), round(v, 4)))
except Exception:
pass
# Deduplicate
unique = list(set(solutions))
for u, v in unique:
stable_u.append({'inducer': ind, 'u': u, 'branch': 'high' if u > v else 'low'})
import pandas as pd
df = pd.DataFrame(stable_u)
n_branches = df.groupby('inducer')['branch'].nunique()
bistable_range = n_branches[n_branches > 1]
if len(bistable_range) > 0:
print(f"Bistable region: inducer = [{bistable_range.index.min():.2f}, "
f"{bistable_range.index.max():.2f}]")
else:
print("No bistability detected")
return df
results = toggle_steady_states(alpha1=3.0, alpha2=3.0, n=2.5, beta=1.0)
Analyze fitness from barcode tracking experiments.
import pandas as pd
import numpy as np
from scipy.cluster.hierarchy import linkage, fcluster
def analyze_barcode_fitness(count_table, reference_timepoint='T0', min_reads=10):
"""Calculate fitness from barcode count data.
Args:
count_table: DataFrame with barcodes as index, timepoints as columns
reference_timepoint: column name for initial counts
"""
# Filter low-abundance barcodes
mask = count_table[reference_timepoint] >= min_reads
filtered = count_table[mask].copy()
print(f"Barcodes passing filter: {len(filtered)} / {len(count_table)}")
# Normalize to relative frequency
normalized = filtered.div(filtered.sum(axis=0), axis=1)
# Calculate log2 fold change vs reference
fitness = np.log2(normalized.div(normalized[reference_timepoint], axis=0) + 1e-10)
fitness = fitness.drop(columns=[reference_timepoint])
# Summary statistics
for col in fitness.columns:
positive = (fitness[col] > 0).sum()
negative = (fitness[col] < 0).sum()
print(f"{col}: {positive} positive, {negative} negative fitness barcodes")
return fitness
def cluster_lineage_fitness(fitness_df, n_clusters=5):
"""Hierarchical clustering of barcode fitness profiles."""
Z = linkage(fitness_df.values, method='ward')
clusters = fcluster(Z, n_clusters, criterion='maxclust')
fitness_df['cluster'] = clusters
# Cluster summary
for c in range(1, n_clusters+1):
cluster_data = fitness_df[fitness_df['cluster'] == c].drop(columns=['cluster'])
print(f"Cluster {c} ({len(cluster_data)} barcodes): "
f"mean fitness = {cluster_data.values.mean():.3f}")
return fitness_df
Design and annotate expression cassettes.
from Bio.Seq import Seq
from Bio.SeqRecord import SeqRecord
from Bio.SeqFeature import SeqFeature, FeatureLocation
from Bio import SeqIO
def insert_expression_cassette(genome_record, insert_seq, locus_position,
promoter_name='Ptac', gene_name='gfp',
terminator_name='T7_term'):
"""Insert expression cassette at specified genomic locus."""
# Build cassette
cassette_features = []
pos = 0
# Promoter (assume 100bp)
promoter_seq = 'A' * 100 # Placeholder — use actual sequence
cassette_features.append(SeqFeature(
FeatureLocation(pos, pos + len(promoter_seq)),
type='promoter', qualifiers={'label': promoter_name}
))
pos += len(promoter_seq)
# RBS (20bp)
rbs_seq = 'AAGGAGATATACAT' # Consensus RBS
cassette_features.append(SeqFeature(
FeatureLocation(pos, pos + len(rbs_seq)),
type='RBS', qualifiers={'label': 'RBS'}
))
pos += len(rbs_seq)
# CDS
cassette_features.append(SeqFeature(
FeatureLocation(pos, pos + len(insert_seq)),
type='CDS', qualifiers={'label': gene_name, 'translation': str(Seq(insert_seq).translate())}
))
pos += len(insert_seq)
# Terminator (50bp)
term_seq = 'T' * 50
cassette_features.append(SeqFeature(
FeatureLocation(pos, pos + len(term_seq)),
type='terminator', qualifiers={'label': terminator_name}
))
full_cassette = promoter_seq + rbs_seq + insert_seq + term_seq
# Insert into genome
new_seq = str(genome_record.seq[:locus_position]) + full_cassette + \
str(genome_record.seq[locus_position:])
# Adjust feature positions
offset = len(full_cassette)
new_features = []
for f in genome_record.features:
if f.location.start >= locus_position:
new_loc = FeatureLocation(f.location.start + offset,
f.location.end + offset, f.location.strand)
new_features.append(SeqFeature(new_loc, type=f.type, qualifiers=f.qualifiers))
else:
new_features.append(f)
# Add cassette features
for f in cassette_features:
adjusted = SeqFeature(
FeatureLocation(f.location.start + locus_position,
f.location.end + locus_position),
type=f.type, qualifiers=f.qualifiers
)
new_features.append(adjusted)
new_record = SeqRecord(Seq(new_seq), id=genome_record.id,
name=genome_record.name,
description=f"{genome_record.description} + {gene_name} cassette",
features=new_features)
return new_record
protein_seq = "MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTLKFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDDGNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIKVNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLLEFVTAAGITLGMDELYK"
opt_dna, cai, gc = optimize_codons(protein_seq)
print(f"Original CAI: {calculate_cai(opt_dna):.4f}")
import numpy as np
from scipy.integrate import solve_ivp
sol = solve_ivp(toggle_switch, [0, 100], [0.1, 3.0],
args=(5.0, 5.0, 0.5, 2.0, 0.1),
t_eval=np.linspace(0, 100, 1000))
print(f"Final: u={sol.y[0,-1]:.3f}, v={sol.y[1,-1]:.3f}")
print(f"State: {'Gene 1 ON' if sol.y[0,-1] > sol.y[1,-1] else 'Gene 2 ON'}")
doc = create_sbml_model(
'glycolysis_simplified',
compartments=[('cytoplasm', 1.0)],
species_list=[
('glucose', 'cytoplasm', 5.0),
('G6P', 'cytoplasm', 0.0),
('pyruvate', 'cytoplasm', 0.0),
('ATP', 'cytoplasm', 2.0),
],
reactions=[
{'id': 'hexokinase', 'reactants': [('glucose', 1), ('ATP', 1)],
'products': [('G6P', 1)], 'kinetic_law': 'Vmax * glucose * ATP / ((Km_g + glucose) * (Km_a + ATP))',
'parameters': [('Vmax', 1.0), ('Km_g', 0.1), ('Km_a', 0.5)]},
{'id': 'glycolysis', 'reactants': [('G6P', 1)],
'products': [('pyruvate', 2), ('ATP', 2)], 'kinetic_law': 'k * G6P',
'parameters': [('k', 0.5)]},
]
)
libsbml.writeSBMLToFile(doc, 'glycolysis.xml')
doc.getNumErrors() after model creation; common errors are missing units and unbalanced reactionsmethod='BDF' in solve_ivpProblem: ODE solver fails with "excess work"
Solution: Increase max_step or switch to stiff solver (BDF, Radau). Check parameter values for unreasonably large rates.
Problem: python-libsbml not found after installation
Solution: Use pip install python-libsbml (not libsbml). On some systems: pip install python-libsbml-experimental.
Problem: Codon optimization produces sequence with internal stop codons Solution: Verify protein sequence uses standard single-letter amino acid codes. Check for ambiguous residues (B, X, Z).
Problem: Bifurcation analysis misses steady states
Solution: Use more initial conditions for fsolve. Add parameter continuation methods for systematic sweeps.
Frequently asked questions
Synthetic biology design and simulation tools. Codon optimization, gene circuit ODE modeling with growth feedback, SBML model creation, bifurcation analysis, barcode sequencing fitness analysis, and therapeutic genome engineering.
The source record exposes this install command: npx skills add https://github.com/synthetic-sciences/openscience --skill "backend/cli/skills/biology/synthetic-biology". Inspect the command and pinned source before running it.
Static rules flagged write-files in the source; the page lists the matching lines and excerpts.
Alternatives
brucesongs/kali-claw
Insecure Design (OWASP A06:2025) focuses on security flaws in system architecture and design phases, rather than code implementation-level bugs.
NintendaDev/unikit-ai
Generate and maintain the project's TECHNICAL documentation from its codebase — scans the project structure, tech stack, and module boundaries, then writes a lean README landing page plus detailed topic pages (architecture, modules, setup, build, APIs), only the docs that are relevant. Use whenever the user wants to create, update, or validate documentation of the CODE or the project itself, e.g. "generate documentation", "create docs", "write the README", "update the project docs", "document th
Jamie-BitFlight/claude_skills
Create high-quality Claude Code agents from scratch or by adapting existing agents as templates. Use when the user wants to create a new agent, modify agent configurations, build specialized subagents, or design agent architectures. Guides through requirements gathering, template selection, and agent file generation following Anthropic best practices (v2.1.63+).
magnus919/agent-skills
Use this skill to reverse-engineer an existing software system, map its architecture, data flow, privacy posture, coupling, quality characteristics, and feature surface, then produce an evidence-grounded clean-room design document, PRD, or migration plan under new constraints. Use for codebase archaeology, implicit contract extraction, architecture health assessment, or decomposition-readiness analysis. Do not use for greenfield architecture design, direct code review, bug hunting, security audi